DPCstruct | MC29868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 14.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510IT33 | 11-134 | TILLISGCSSTPEVPTSESFVTDITELGHKRFTYKASQEIKPSGRGGRGNKPSHGPGMGGGGKPPGGKPGGGKTTSGDIKKTAMERI… |
| A0A7W7UMN7 | 1-112 | MRLLSATLWLLVPLLSACSSLPGQVYDGPEPLFLTHINEEGSKRFTFEAAPNDTLPRGLSAAQSLRLLEQREALQQDLLTETLATKQ… |
| E1STZ3 | 3-146 | None |
| A0A2D4S7G1 | 18-125 | None |
| A0A2S0VMJ1 | 1-165 | None |
| A0A3B6XZ36 | 5-130 | None |
| A0A3N1NNY2 | 1-139 | None |
| A0A0F7M0Y0 | 16-135 | None |
| E1STV1 | 1-121 | None |
| A0A3S5CTX4 | 116-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.