DPCstruct | MC29867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 137 ± 28 aa |
| Standard deviation of domain lengths | 28.39 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1LDV9 | 488-630 | TAIPYIIKTLLREKWNLYVPLSLVDANIKRSSSINACIVQKFYMRTNIFENRINIKEMTTFDIFFGELGLINRCMQHLEADYKSGLF… |
| A0A818Q0Z2 | 337-453 | NQISEMFMNEIINGTQDFLGLVPLTRKYILQREDIDADTRHTIEQYLSLISKRAAGTLLTNASWIRQFVLSHPSYKQDSIVSEEIQY… |
| A0A7R9KGT9 | 1062-1200 | None |
| A0A2V2VQW3 | 272-404 | None |
| A0A2C9K396 | 179-341 | None |
| A0A7S2K482 | 3-141 | None |
| A0A1V6SXK4 | 21-112 | None |
| A0A1R0H001 | 429-523 | None |
| A0A1R0GRS5 | 6-91 | None |
| S4R6I2 | 9-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.