DPCstruct | MC29866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 334 ± 38 aa |
| Standard deviation of domain lengths | 37.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4RID6 | 36-359 | TSEPVRSPERFKPERNRHGVNLQKLQWRNSNWVDGFPEMVSSMTIADVSPRFAVKRIILLYENTQYREAANFINRLSHGTFKTILNQ… |
| A0A818NMK9 | 1-329 | MSSIRNISVDVASIRILQYLRTHNYDDCAIYINRLNSNTFRKILNTDLSIDILLAQLPFSIEIFEVIYSKIFIIDPDTFPLQILKPE… |
| A0A813Z117 | 1-403 | None |
| A0A1I7WB84 | 1-274 | None |
| V4ANF9 | 1-300 | None |
| A0A2G8LD72 | 15-377 | None |
| A0A814WNG0 | 2-329 | None |
| A0A2K6VIQ3 | 1-339 | None |
| A0A3S3PKV1 | 17-370 | None |
| A0A6L2PMP5 | 98-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.