DPCstruct | MC29864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 206 ± 40 aa |
| Standard deviation of domain lengths | 39.77 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183KT08 | 2-149 | PGCFFQLRLFRVFQKFLHDRALATSPEFKELANLIKYILRKFFEAEEKNNYILIETLFFKTPKESYETVQGYGTFESNKKTIHWTSE… |
| A0A7R9R103 | 2-190 | LHRISFDCKMHAMLFQASVFRTFQRILADPLRDSGAVKELKRFAKFILSKFVLAANKNNKIFFELLFWKTSGEAYQVEEGYHTTRNL… |
| A0A1D2NBN0 | 16-220 | None |
| A0A5K3FLM4 | 423-617 | None |
| A0A5K3FJF5 | 716-910 | None |
| A0A6A3D3A0 | 114-426 | None |
| A0A164MN00 | 3-159 | None |
| A0A218UDP4 | 2-144 | None |
| A0A671N5S9 | 507-693 | None |
| A0A1S3IFF9 | 180-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.