DPCstruct | MC29860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 5.49 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6YNI9 | 9-93 | VLVEEILPKVRKPLRYLGNEYNTVKKDWKAVKLRSLFAFPDVYEVGMSHLGLQILYGLVNEQAEYLMERVFAPWPDMEEELRIRG |
| A0A1I7EXD8 | 179-269 | QLLEQVEKPARYIGGETNMVVKDPEKMDVRFAFAFPDLYEIGMSYMGLQILYDVTNRHENLYLERVFSPAPDMEELMRKHHVPLFTL… |
| A0A812ADY3 | 4-95 | None |
| A0A2M7DS19 | 1-92 | None |
| A0A6G1ST04 | 185-271 | None |
| A0A2V6XQH1 | 15-90 | None |
| A0A7C0VC28 | 1-91 | None |
| A0A6N2E747 | 119-218 | None |
| A0A150FUF1 | 84-177 | None |
| A0A519BLG4 | 14-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.