DPCstruct | MC2986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 450 ± 79 aa |
| Standard deviation of domain lengths | 78.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EZW2 | 7-426 | KSFKKGLYIVSLVHQKGKVLVTGEDVLPTIEIQCEQTPSSVALKSDFYWLSKVICNWSNVKPLKNIFERPSTITDSLHFRSCLLQSV… |
| A0A022W0E6 | 1-488 | MAKRVQQLSLACAYFDSSGSVMVAPDGSIPTHKITNHYVERSFADDEFNRVHPAFLWAFRASRNWTHLKQFIRGMNYNIKSDESMKQ… |
| A0A420I2T1 | 2-438 | None |
| A0A6P7EMG1 | 1-311 | None |
| H0EQP6 | 26-480 | None |
| T1F4T2 | 193-605 | None |
| J9AYF5 | 5-388 | None |
| T5ABX8 | 261-666 | None |
| A0A7J7TJX1 | 74-613 | None |
| A0A5B7EWR4 | 12-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.