DPCstruct | MC29856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 7.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 40.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085FP84 | 16-88 | KPNREETEELYRLRDLEVEALAKQSVITIADIQALEWGGRFKIANEHLDKCDEQARHALVHDQHHGVRSAAVL |
| A0A6N8BQT6 | 3-79 | KTLSQAEVEQLYADNAAHEARLAALTNIDVADVIALHRHVRFFVASELWARLTQAGRTALLNDGHPHVRSAAEISHR |
| A0A1H4ZZ09 | 52-121 | None |
| A0A6P2TBJ5 | 122-222 | None |
| A0A1E3LMV4 | 581-656 | None |
| A0A1R3FGE8 | 20-94 | None |
| A0A6P3BYQ4 | 167-241 | None |
| A0A1H8Y7Q3 | 4-77 | None |
| A0A2T1AUR4 | 102-181 | None |
| A0A1N7ESB4 | 2-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.