DPCstruct | MC29855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 481 ± 55 aa |
| Standard deviation of domain lengths | 54.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8BQR8 | 50-596 | DWRDIQKIWDTLHTQWSDIRATHERLYGFKPRGVEAREISLSIGGKAITLPGGYYPAVYDPQLSKEVAGRNEKQDALARGEAMYAVP… |
| A0A496JZ16 | 2-362 | GAQAKQKLNKALEDIARGNTAPVNGLDKYSGLIRQNVSMTGLGFNVVSAAVQITGFIPAVARLGGKYAWAGLSQYTTHPIKATQSAM… |
| Q2IIU8 | 192-626 | None |
| A0A847YVY5 | 2-492 | None |
| A0A7V8ALW0 | 232-708 | None |
| A0A1H3W3F3 | 1-603 | None |
| A0A2G6M137 | 794-1272 | None |
| A0A2D6TQ00 | 291-776 | None |
| A0A847CCB8 | 237-749 | None |
| A0A6M3XMD0 | 558-1009 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.