DPCstruct | MC29853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 168 ± 28 aa |
| Standard deviation of domain lengths | 27.59 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.79 |
| Pfam Score | 46.49 |
| Assigned Pfam label(s) | CL0023- PF03849- PF13625- PF18307 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5X6L2 | 275-427 | PQLGSQVYVLDDLSIIAPGPLASDTARALDRVATSEAHGLAPRYRLTTIALHHAFAHGDTADSVIGLLESMSLVPLSATVRSFITDA… |
| M3HL95 | 1-168 | MSKPLIVQSDRTMLLEVDNPEFEACQSIVSKFAELEKSPEYLHTYRISPLSLWNAASIKMTADEIVECLEKFSRYSVPKNIVNEIRE… |
| A0A0F7SUA4 | 641-815 | None |
| A0A6V2GKL7 | 61-246 | None |
| A0A6A5DES2 | 146-351 | None |
| A0A6A5DW76 | 980-1152 | None |
| A0A7W1A817 | 158-316 | None |
| A0A7K0W0R9 | 26-207 | None |
| A0A847A3H0 | 220-387 | None |
| A0A523DNI3 | 433-600 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.