DPCstruct | MC29852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 156 ± 20 aa |
| Standard deviation of domain lengths | 19.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 27.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3GJ08 | 30-188 | NHNISALRTNNVLKSVNKELDKTMEKLSTGLRINRAGDDALGFAMSEKMRTQIRGLAQAERNVMDGVSFIQVTEGTLEQVNNILQRL… |
| J8S803 | 2-149 | AGLAISTSMTSQIRGMSQGIRNANDGISLAQTAEGTLSEVGNMLQRVRELAIQSASGTYQTSDRAAMQQEVSALTTQINDSFTQAKF… |
| A0A2H0PJF0 | 1-160 | None |
| A0A1P8WPE3 | 33-178 | None |
| A0A7W5FG17 | 2-157 | None |
| A0A254PRF7 | 1-170 | None |
| A0A1I4B6P0 | 5-153 | None |
| A0A0F7RKW3 | 9-175 | None |
| A0A6J4GYW0 | 1-161 | None |
| A0A357Y5G4 | 12-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.