DPCstruct | MC29850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 393 ± 86 aa |
| Standard deviation of domain lengths | 86.21 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0273 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1SK77 | 22-309 | ASMSLTFKWEAKPEHCLCTPSPSATAVFHFSPGWKDKRVALLESTEELEYLLLMACVLDSEASMVWPAGDENTRNTIIEEVRQLISQ… |
| A0A671VQ32 | 32-405 | AETVCMGNKVSGVKLHSVTCKGSTVDKKSLITLDELKQEHKRRCHPSSMAIKGSARFLLLGSTVVENTLIKSQSSVTVDFKWSHVES… |
| A0A7R9B067 | 12-400 | None |
| A0A0L7QY68 | 14-385 | None |
| A0A6V7Y799 | 1-432 | None |
| A0A2T7PL55 | 27-370 | None |
| A0A044SLY4 | 665-1102 | None |
| A0A1I7S3Y7 | 198-550 | None |
| Q1DGN9 | 53-466 | None |
| E4YQE6 | 207-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.