DPCstruct | MC29849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Standard deviation of domain lengths | 17.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5ZTP2 | 3-144 | IVELGPWIIQIESNQEEIATNSSCPCLYCLNFYYTVDQMDAKETKVLKKLGIHPLNPIQLSYFGETESQEHLYSGSFHVKGTLLVGK… |
| A0A316PL78 | 84-206 | MNINVSGTRAFYHSITESSLCDCGYCRNYRLQVRSAFPDVAVYLGSLGIDIEKPFETSPLEPDENGMLEYCCCQYIALGNCNPEYHH… |
| A0A4Q3ZHY5 | 3-143 | None |
| R6IP52 | 1-139 | None |
| A0A7V3T870 | 3-142 | None |
| A0A2A4RNY4 | 75-222 | None |
| A0A2V5ZHF5 | 3-152 | None |
| F4XAE4 | 2-152 | None |
| A0A841H866 | 10-175 | None |
| A0A349DCN3 | 3-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.