DPCstruct | MC29840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 69.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5JX30 | 3-77 | ASQYWLSLLVLSCCVALLLPSCAQGAPQEPVYPGDDATPEQMALYAAELRRYINRLTRPRYGKRAVGQRIYQDGV |
| P48098 | 2-93 | VSPRVRLAALALSVCAILCLGMHASAFPPKPDNPGDNASPEQMARYKAAVRHYINLITRQRYGKRALTPENWIYRDPAEERVTYGLD… |
| A0A6J0J7L8 | 1-81 | None |
| A0A3B1JII6 | 2-81 | None |
| A0A6F9CQE0 | 1-94 | None |
| A0A6F8ZMA6 | 1-90 | None |
| A0A553NJW8 | 1-81 | None |
| Q58VQ2 | 1-87 | None |
| A0A4W5KZ01 | 52-146 | None |
| A0A7N9AQG0 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.