DPCstruct | MC2984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 206 ± 15 aa |
| Standard deviation of domain lengths | 15.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6VHN3 | 1-204 | MGRQAYLDKIAFGRSAFEPTQSASVSSEYIQLESSQSEIPARYHEASAHNYMQLYDERGNPINPRSQQYGRKLRSAQNDVLASVGVV… |
| A0A022VV54 | 1-223 | MGRRPYLNSLALGRSPYEAPELIVNGSAIPQPNRHLANSNADGYVQEYDARGHPINRRSKAEARQLRKAKNDVLSTMGIVVSGEELN… |
| A0A6V8QYA1 | 1-188 | None |
| A0A4U0XG33 | 1-230 | None |
| A0A3M7HMC9 | 1-215 | None |
| A0A4V6WKD6 | 1-200 | None |
| A0A6N4SL57 | 1-211 | None |
| U1GBD0 | 1-178 | None |
| A0A0C4E4K1 | 1-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.