DPCstruct | MC29838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 255 ± 14 aa |
| Standard deviation of domain lengths | 14.27 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09338 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B2A2P8 | 3-252 | RHLEIQGFQISELNLNSHGRTEIQGNKLLVNSNITQEVAAKYPELKDIKMRVFTSKDEDIEVNTMMDVIPVKTKMEDKMGTGTTLEL… |
| A0A7Y8VSH8 | 142-414 | KAIQILKSKVRKSFAFKKRQSELSGTDKIIGSLRRNYISISTAQFGDNTSINGEKLTIRTDIVAPLVAAEPRIRDCHISFLLPHDSK… |
| A0A0P8WM07 | 141-393 | None |
| A0A162MLH3 | 1-294 | None |
| A0A2V7HQ99 | 244-498 | None |
| A0A1B2I777 | 5-249 | None |
| A0A7C6VC40 | 2-256 | None |
| A0A4R2JAT4 | 1-252 | None |
| A0A428MVH1 | 125-370 | None |
| A0A3B6VMS1 | 1-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.