DPCstruct | MC29837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 203 ± 20 aa |
| Standard deviation of domain lengths | 19.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A854IFY5 | 136-304 | VPESIANMVAQYRRVTEDPDTRWDDISFADARAWIDAAIELAAITFPPLQTETWPACRALVEWIIRGLPEGGTGYQRPQWDSATLVR… |
| A0A2T2RER8 | 7-203 | VAGPPAEITAIWREHLADGQAMACEALDATTAGEQLRTALTATDRDDHAPVSDDFAATRALAWARAATLPHAPRATAPAVDRDALIA… |
| A0A2A7NAF7 | 33-222 | None |
| A0A543PDH5 | 134-343 | None |
| A0A3D5DP14 | 2-190 | None |
| A0A7G8PLP3 | 142-358 | None |
| A0A0Q9M614 | 149-388 | None |
| A0A3N1B0S1 | 388-611 | None |
| A0A1R4HZ44 | 98-302 | None |
| A0A651GGB6 | 150-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.