DPCstruct | MC29835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 127 ± 7 aa |
| Standard deviation of domain lengths | 7.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7ED86 | 565-688 | VQQCAQLSMDVQMYMYANEFTDEEKSPEYGIKGWPNWHVGVLSMYGGHVAINHCTRDFGVVKDAHNLDFPTTSHESPTRHAHLHTWQ… |
| W4H5K6 | 1-141 | MVQDCGKLSMKVIDHLHLHEFNATEKSDEYAKVRVTGWPRWHYGVLTMYSGHLAIPSCTNATGFDKRNDLLDFPTFSNDSVANHAHL… |
| A0A814PV69 | 61-195 | None |
| A0A024UJD9 | 23-149 | None |
| A0A397AF18 | 1-118 | None |
| A0A6G0XDI2 | 389-512 | None |
| A0A024UK41 | 573-704 | None |
| A0A818CZK1 | 284-403 | None |
| A0A6G0XD49 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.