DPCstruct | MC29830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 10.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9G3Y3 | 3-71 | LVWRKPSKAEERARVVAWSCHCRTIVYELCRAAGQSYIRRTEYDDNGESVYETYRWSFKEAAEVWAALL |
| A0A7X0NQW4 | 78-166 | HAFPHPKPPQNGHARIDWAPSVGRCASARVRDLTCECLPTSYELCAAAGLLHIRRTQRTPQGVRISESPWLRTAQGLALWTALLEGR… |
| A0A7K0BZ80 | 4-89 | None |
| A0A544XY28 | 4-92 | None |
| A0A5M3Y0S0 | 163-249 | None |
| A0A544XVN1 | 2-62 | None |
| A0A1Q9UGK6 | 29-122 | None |
| A0A4R4TY86 | 23-89 | None |
| A0A7K0C1B1 | 5-75 | None |
| A0A1I3REG8 | 4-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.