DPCstruct | MC2983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19452 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8SNS1 | 58-135 | LGKFAQGPKDSRFVYVNSGTYAGQHPTAWGRRAKLSLMSITKQQVQNAIENGSIIETTMPGVGRDGGPTCASVKGLEW |
| A0A2E9C1Z0 | 12-107 | SLADGSPNFRGPFAQGTPADRFVYVNSGLSAGQTGTPWQRRAKIKLADIPIALVERAAGDPNAAIEACIEGTMKDGGPVCASVRAPQ… |
| A0A7W1HIZ2 | 25-115 | None |
| A0A3N5KFD7 | 56-146 | None |
| A0A3N1PDP7 | 8-91 | None |
| A0A163L7Q7 | 191-274 | None |
| A0A2N3GTT0 | 1-68 | None |
| A0A1H0VIR7 | 2-81 | None |
| A0A7V8XRR7 | 355-435 | None |
| A0A1X1TAC2 | 68-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.