DPCstruct | MC29826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 157 ± 20 aa |
| Standard deviation of domain lengths | 19.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482V452 | 7-173 | EKEAKKRVERLGDLKQLVEAIENKMLVPCSLVCCPVCCPPCLQDVVKEAPTPPQPPDTMVCYKIEKKEKRKASRNTKKQEQPKRTKR… |
| A0A1B6E8W8 | 1-192 | MSHNELICHATGEQRKKLIKDLKSYVDKLENNLPIVSKREPIGKPGGRLLKKYIGCVEKKQKIPRPPNVEKPIITNIQVHESRPTSQ… |
| A0A194PPZ2 | 1-141 | None |
| A0A7J6ZSG6 | 2-127 | None |
| A0A2R7W6K9 | 4-175 | None |
| A0A6P3WTR7 | 1-162 | None |
| A0A1B6DNX7 | 73-210 | None |
| A0A653D3J3 | 412-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.