DPCstruct | MC29824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 170 ± 9 aa |
| Standard deviation of domain lengths | 8.67 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139WAK0 | 164-339 | MGPQLYSELVQMCKTYNPDTKMVLYVSVCVVSETPATGAVKWERQLVSRCAKMRLSKDFFFSVPENPETLILTCNSIEEGNEEAKKL… |
| A0A1B6E696 | 22-183 | LVLYVAVCVVSEVPTTGAVKWERQLVSRCAKLRISRSLIPPKQVTANITRDSEDPETLILTSLPGVSQGSQRARQISFTNIQRHLRQ… |
| A0A7E4RV19 | 291-459 | None |
| A0A814HTY1 | 146-325 | None |
| B4GJB5 | 17-208 | None |
| B4GJ20 | 309-480 | None |
| A0A212F625 | 1-155 | None |
| A0A093Q195 | 194-358 | None |
| A0A6P3R515 | 494-668 | None |
| A0A4Z2J8G9 | 131-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.