DPCstruct | MC2982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Standard deviation of domain lengths | 6.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.50 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF02428- CL0482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5XPI6 | 22-81 | LAINPTEAKVCNKICYGAAAYMTCPSSGSTQLDPVCNCCLAPALGCTLYESDGTPICTST |
| A0A6A4R7C6 | 6-68 | VLFMKSVEGSSKICIEPLVCDDAAYMICPSSGSKHVAPACNCCYAPIGCKLYRANNTVICTST |
| A0A1U7VLC3 | 8-65 | None |
| A0A1S3YTB5 | 93-158 | None |
| P83241 | 1-52 | None |
| A0A1E5UNA0 | 56-123 | None |
| A0A1E5W186 | 48-126 | None |
| A0A5N5J5B8 | 596-653 | None |
| A0A2I0XG42 | 114-168 | None |
| A0A6A4MYI2 | 30-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.