DPCstruct | MC29819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 19.26 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0D7K1 | 2-98 | FDFFDSGIMEGLQHRLLISSSLASGPDGSLVFRGRKMGRRVPKSGIPEIYVSWIPSDIISDEWIQEPKDGSSPITKTVAIESLNNSE… |
| A0A4Y2EQU6 | 1-136 | MSRNVIAARKFPKLIIDDEDKSNDFFDDASMELVRHNLFQLSSIEGMNCGGPPSAITFHSTVVGRRVDPTGKVHILLHWNPEDMIPD… |
| A0A7J7ISG4 | 4-119 | None |
| A0A7R9ADG7 | 44-198 | None |
| A0A3B4A9S2 | 131-277 | None |
| Q17PR1 | 1389-1480 | None |
| A0A1S3FXE1 | 145-275 | None |
| A0A034VKB8 | 3-121 | None |
| A0A5J5CIK7 | 8-169 | None |
| T1EP13 | 69-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.