DPCstruct | MC29817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 3.77 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 81.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2PD24 | 1-74 | MSIFAGAWKCDLKILAEELGETVNDSHKLKDLKKIILASKEYDEESAKEWTNTIINERKEREVIAEQKRQEVIA |
| A0A4Y2EAR9 | 1-73 | MSIFAGARKCDLKILAEELGETVNDSHKLKDLKKIILASKEYDEESAKEWMNAIINERKEREENEIRQEEIAE |
| A0A4Y2EQP4 | 27-98 | None |
| A0A4Y2ESZ2 | 1-67 | None |
| A0A4Y2BCJ8 | 1-67 | None |
| A0A4Y2RUS6 | 75-136 | None |
| A0A4Y2RJZ8 | 52-116 | None |
| A0A4Y2EZG5 | 1-67 | None |
| A0A4Y2GU39 | 1-72 | None |
| A0A4Y2DFD5 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.