DPCstruct | MC29814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 2.89 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 56.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3VPL0 | 1-67 | MCNNKREVHHKLPLDDGGTNDFSNLVLIKNDPYHQALTNYQKKVTKGMSAGESKTVTWYTMEGNIYP |
| A0A4Z0GHD1 | 93-154 | YNVHHKFPLDDGGTNNFSNLVLIKNHPYHKILTKYQIAKTGHMQEGDSIELKWPIPKKYIYP |
| Q665T8 | 389-458 | None |
| A0A8A3QHZ7 | 157-222 | None |
| F2C4H5 | 176-240 | None |
| A0A0E8XG04 | 36-105 | None |
| A0A6L9FGW6 | 276-343 | None |
| A0A2X5AXT8 | 115-184 | None |
| A0A853NIE1 | 94-155 | None |
| A0A496MB63 | 25-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.