DPCstruct | MC2981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 147 ± 21 aa |
| Standard deviation of domain lengths | 21.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4R1N3 | 1-163 | MAASSTFSNLLSLILPTKQSSIPSPPHNLNFSLSSTPLQKISSFSHDFSSVMNPSLAYSNTLLFKSAYNVQVVVGDDEPEERLLNRF… |
| Q6YUV4 | 1-122 | MAAAPATTSLLSALLQLPLAPFSGRRSPPPPSVVHVAPPRSPTAAVAATKGYNVQIVVDENEGEESIFRRFRREVMRAGVLQEIKRR… |
| A0A287TWW0 | 2-106 | None |
| A0A835F3Z2 | 1-146 | None |
| A0A5A7QNL0 | 97-277 | None |
| A0A835RPJ5 | 18-147 | None |
| I3RZW2 | 1-181 | None |
| Q6YRN2 | 3-120 | None |
| A0A7J7I9A2 | 1-167 | None |
| A0A830BD50 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.