DPCstruct | MC29805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 244 ± 32 aa |
| Standard deviation of domain lengths | 32.01 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3AYZ2 | 106-321 | ERTGVDSFGDLSYLLQQSYEVEFGRAVRIAHRQEWPSVWGGRSTQGAAQSWMRSVKSTELLLYTREQYRAIAKPLGIWAESQRATHN… |
| A0A813HE32 | 32-277 | LRPRECIVPEVSRTHHFDTSGTNVKAGSELAKKLERMATSRLPPKQLGDLSYLLHDDYEAKLMELARGAKLISGSQLGGLKGNEVYL… |
| A0A7J6UF83 | 1-230 | None |
| A0A7S1QIS8 | 352-630 | None |
| X6PAQ8 | 76-323 | None |
| A0A812I7K9 | 254-435 | None |
| A0A7S3AC40 | 7-341 | None |
| A0A7J6KTR8 | 529-787 | None |
| A0A813JRY9 | 348-570 | None |
| A0A812QJD8 | 216-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.