DPCstruct | MC29802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 672 |
|---|---|
| Mean domain length (aa) | 143 ± 30 aa |
| Standard deviation of domain lengths | 30.43 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.52 |
| Pfam Score | 98.98 |
| Assigned Pfam label(s) | CL0003- PF04553- PF15697- PF08588- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0R7R1 | 330-435 | LINFKNQPCKITTQHNHKHCPYYHNAKDRKRPGTFYSTDLCEYIEKNENCPFFINCPKSHNRVEQLYQPDKYKTKFCTFYPNKVSQC… |
| A0A813H677 | 16-138 | LQLFKTDLCKFFLENRCENGDSCSYAHEGVEVREKPDLTRTSMCRMLVKNGVCNSRTCRFAHTESELRATHGFFKMKMCVFAQSGRC… |
| A0A6G1EMR6 | 9-130 | None |
| A0A0D2MEJ6 | 1-115 | None |
| U6KMM5 | 3-157 | None |
| H2AMF3 | 1-133 | None |
| A0A1Y1UDP3 | 173-310 | None |
| A0A1Y1V344 | 12-169 | None |
| A0A6P6C3U0 | 33-206 | None |
| A0A835XWI9 | 411-538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.