DPCstruct | MC29801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 491 ± 109 aa |
| Standard deviation of domain lengths | 108.57 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2DYE6 | 42-549 | LVKTNDSVQELYKRWGGAAEDGKFVAELKEVADVRDFPRQKREVEMPQLWAFRSSVTLDALHKHLGMQKNASEALPVLCTVLQQPLF… |
| A0A813GWB2 | 3-406 | ALGTLVGVFEWHALVTNHFSGRITRTEAGTKTVREVMNGLLPTERGRWERAYKQFERAWHLAWPHVERHECLELPENLRKMMIDRDS… |
| A0A2N1NW54 | 37-510 | None |
| A0A815D9D1 | 9-572 | None |
| R7T731 | 718-1254 | None |
| A0A813BNP8 | 2-414 | None |
| A0A7S4P396 | 210-538 | None |
| A0A820UBT4 | 7-489 | None |
| A0A821JCB9 | 5-353 | None |
| A0A820XXJ7 | 101-563 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.