DPCstruct | MC2980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.60 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0023- CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453T949 | 107-165 | TPCCESAYKGGYCGERSHSGKRLYDLCETPDKMFYWDQTHPTHAGWEAVMKALQQPLME |
| A0A6A4R1P8 | 1-68 | MNPLQPCCSKMKAGYQCGQVDENGNKKYTLCENPELSFFWDNVHPAQNGWYSIFKKLEPSLSQIIGTN |
| V4T9E3 | 99-160 | None |
| A0A445IKU3 | 331-383 | None |
| A0A368Q6L2 | 146-205 | None |
| A0A2U1N218 | 198-249 | None |
| A0A5D3DNZ8 | 1-60 | None |
| A0A446RB83 | 118-180 | None |
| A0A453H014 | 305-367 | None |
| A0A2K2CLX3 | 34-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.