DPCstruct | MC298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9NK28 | 7-127 | VHLRFGDPARTAGTHRNLSAVRSDGAVLWVAGDETATIERLVADDPGEPRRYAQQAGVRLADLVELPGTRDDEADIEGLARDGCSLW… |
| A0A6N9XWD9 | 1-100 | MELRFGLQSREAGTHTNLSAVRQDGRCLWVAGDETATIERLTAALDGDGRVTGYEGQTTVALADLVPLPAGPDEEADIEGLARANGW… |
| A0A0D6KKQ3 | 3-112 | None |
| A0A2D6CZ21 | 1-135 | None |
| A0A858R9M5 | 20-153 | None |
| A0A8B0TGD1 | 43-171 | None |
| A0A1E3H888 | 1-130 | None |
| A0A1M4L2W6 | 15-151 | None |
| A0A4R1P1L5 | 3-104 | None |
| Q05I22 | 4-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.