DPCstruct | MC29798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 212 ± 42 aa |
| Standard deviation of domain lengths | 41.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383VVR5 | 452-665 | KSELEVGSSSSSRSAAAAAAAADPQQQQQQQQQLEDAEALANIPVAITSMMTCVAGIGILLPLVAGASSSSSSSSSSTPQHILDVVQ… |
| A0A383VU42 | 1-207 | MGSALEAAVCHLQEPPAADNCEQHGAAAAQQDVLKVLSEGVVWCEHCVDSLLSGLNVAGLPADVMLLLEGQGQAALAVLKKLRDDAK… |
| A0A383WA14 | 1-171 | None |
| A0A383WFL9 | 280-434 | None |
| A0A7J7PNN0 | 350-556 | None |
| A0A7J7Q3I1 | 568-808 | None |
| A0A7J7PMS4 | 1-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.