DPCstruct | MC29796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 358 ± 70 aa |
| Standard deviation of domain lengths | 69.62 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383VS08 | 8-361 | AFNGASSGSAAAAHAPPAAFLQAGQAAAASPPATDTASIAVDHQQQLQRFQQQYQLLTQPLQQIIAPPEDPLALFKHLFQQPMYPGV… |
| A0A5J4XNM1 | 20-294 | TITLTVLGKSLEKTVQDVAAMPFTEFATLYAAYAQKIKHCLAQISHNENDTAAAQEVRMWTCQCNSMRMFLAVGDLSKFAAFSSSRL… |
| A0A2V0PG34 | 8-200 | None |
| I0Z5S6 | 119-498 | None |
| I0YRN3 | 18-273 | None |
| I0YR48 | 43-349 | None |
| I0YPK2 | 2-336 | None |
| I0YKX2 | 183-531 | None |
| A8JDV0 | 1-335 | None |
| A0A383VXN5 | 125-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.