DPCstruct | MC29793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 141 |
|---|---|
| Mean domain length (aa) | 221 ± 41 aa |
| Standard deviation of domain lengths | 41.13 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.45 |
| Pfam Score | 91.47 |
| Assigned Pfam label(s) | PF00177- PF02104- PF20456 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A097EIX4 | 6-194 | LIPTLVVVTAVAAMIALGLWQLLDRAPKKEAYLAQLAANPAKPPIAFPATPDDRLLFRRTTATCARPLGQRLAGAGAAGFRLIADCG… |
| A0A383VI32 | 8-250 | LLFLPSAVAATMAAWQVQRMQWKQGVVDEATRNMEQQAVDLLQGTVPEFRRVAVQGTYDHSRTAFVGPRPLSYEPKDPAVKLGMRPM… |
| A0A7R8X4Y6 | 63-297 | None |
| J6FBI8 | 40-241 | None |
| A0A1D8NQR7 | 180-430 | None |
| A0A2A6FSZ5 | 80-356 | None |
| A0A433RZD0 | 21-244 | None |
| F4PXC1 | 23-219 | None |
| A0A1P8ASC1 | 1-252 | None |
| A0A2Z6MEF8 | 38-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.