DPCstruct | MC29792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 120 ± 25 aa |
| Standard deviation of domain lengths | 25.18 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2QYH6 | 1-90 | MVPRCQVEGCHVALVNAKEYHRRHRVCDMHSKAPKAVVLGLEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKSSHLSVTRN… |
| A0A383VFQ2 | 18-177 | ANTWAEASLPNAMELSYLETQDTMTTDQQEVPAATARPKPKRMCQVPGCTADLEAIGKPYCCMKRICPVHMKADVIPMCDQYMRYCQ… |
| A0A0K9QHK9 | 13-95 | None |
| A0A0K9QJ27 | 1-93 | None |
| A0A2N9I8L7 | 1-87 | None |
| A0A5D2LCD2 | 36-158 | None |
| A0A2U1N651 | 20-158 | None |
| A8JCK4 | 1-80 | None |
| A0A3N7GZ77 | 22-163 | None |
| A9TKM8 | 397-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.