DPCstruct | MC2979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 146 ± 26 aa |
| Standard deviation of domain lengths | 26.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287U5D2 | 153-279 | HTSIGELIIQGEHALRDTYCFFEEFQAEMLDGITGEKWDPVVLGGAESGDTIGVHGHGADMETGLRCQGGLDTWEVRCVCGAQDDDD… |
| A0A6A4QZG4 | 1-164 | MNATVYDLKVEATNAFQDIYLMFRRFQVDELLGYRGVDDSTQVNLLLGSNETVCMRGRFIGKNGLSKFRMERGLERWTVDCSCGAKD… |
| A0A4P1R8C1 | 1085-1221 | None |
| M1A5Z2 | 112-264 | None |
| A0A5E4ECJ6 | 189-281 | None |
| A0A2P2MM78 | 73-199 | None |
| A0A484KWB0 | 830-959 | None |
| A0A2G5DU39 | 370-533 | None |
| M1DCM2 | 124-306 | None |
| A0A2U1MVK7 | 1051-1180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.