DPCstruct | MC29781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 175 ± 27 aa |
| Standard deviation of domain lengths | 27.45 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3GEN8 | 1-189 | MVYSRSASTRAYAKAVALCALTLVALSHAVAQGDEENTVACEVSDGDKSFGVRVVDDAGCANGGLGCYNDHCRYCKIIDTPKSTEFE… |
| A0A397AY09 | 42-178 | VGTTSLSNNSGGAGACVAVQLIPSVEGANGVSVFSDESCEKDATNCVPLTYCRKCKLYDTALSFPFKSCPPSAFPAVMSSSQVNCPS… |
| A0A225X337 | 27-180 | None |
| A0A6A3TNI6 | 1-157 | None |
| A0A0P1AWB5 | 1-196 | None |
| A0A1V9YL22 | 1-141 | None |
| K3W7B6 | 642-896 | None |
| A0A3F2RFT5 | 28-196 | None |
| A0A2P4XE53 | 276-471 | None |
| A0A5D6XPH8 | 3-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.