DPCstruct | MC29780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 298 ± 61 aa |
| Standard deviation of domain lengths | 60.98 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.74 |
| Pfam Score | 87.73 |
| Assigned Pfam label(s) | PF02138- CL0266- CL0016- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3G5Y7 | 41-352 | DVVQFHEALMARRPLLLKRDPTVRRLRHPSSLFRNSPMSNRWVQNEISTFEYLMWLNTIAGRTYNDLTQYPVFPWIISDYESATLDL… |
| A0A3P9IDY9 | 21-277 | EVFMANRTSVMFNFPDQATVKRVVYSLPRVGVGTSYGLPQARRISLATPRQLFKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDL… |
| B4IP02 | 340-617 | None |
| A0A815SWX8 | 120-481 | None |
| A0A5K4FC43 | 156-539 | None |
| A0A6F9CJ11 | 13-210 | None |
| A0A6P7EFT2 | 1-199 | None |
| A0A3B0MRH4 | 310-690 | None |
| Q19317 | 1771-2112 | None |
| R1GWC0 | 194-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.