DPCstruct | MC2978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0408- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2WSL3 | 35-111 | GKLDLLMSNIGISAMHMQLLNNDRVVMYDRTDFGASNISLPNGKCRNNPNDLALKVDCTAHSVEYDVSTNSIRPLMV |
| A0A6A4QPR6 | 9-114 | LILFVLATFPCYFQLLVESQTPFGYLGQWQLLQASIGISAMHMQLLHNDKVIMFDRTDFGPSNLPLPYGHCRVDPYDKALTTDCTAH… |
| A0A2T7CEQ9 | 1-114 | None |
| A0A0C9U9Y9 | 1-104 | None |
| A0A151TIR3 | 4-93 | None |
| M9MBR3 | 198-304 | None |
| A0A146HSZ8 | 1-99 | None |
| A0A2G2WX41 | 278-366 | None |
| A0A396HI38 | 45-135 | None |
| A0A0D3D7Y2 | 7-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.