DPCstruct | MC29778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834H8C4 | 2-74 | DWASNFFVATSMLQQPLEEELGEMEPKPSCIISDMGFPWTIELASKFHIPRIAFHGTCCYSLLCSHNLTVYNV |
| A0A3L6SGR5 | 1-74 | MAFFESVWKMDAPLEEYVRSLPRRPDCLVADSCNPWAAGVCARHGIPRLVLHCPSAYYLLATRNLSKHGVAQYF |
| A0A446Y7K5 | 1-75 | None |
| A0A7J7HSI8 | 1-69 | None |
| A0A396H993 | 14-95 | None |
| A0A0A9D0E6 | 1-80 | None |
| A0A453EAA6 | 162-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.