DPCstruct | MC2977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 43 ± 3 aa |
| Standard deviation of domain lengths | 2.65 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 75.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0431 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6GCC8 | 1-41 | MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGAVWAQSTAFPQ |
| A0A6A4QIK5 | 1-47 | MSWQTYVDEHLLCDIEGNQLTSAAIIGQDGSVWAQSSNFPQVPFFNY |
| A0A438DS25 | 1-48 | None |
| A0A287W6D4 | 1-42 | None |
| A0A426YNI0 | 1-44 | None |
| B6TJ90 | 1-41 | None |
| A0A5A7QPS0 | 651-691 | None |
| A0A1D6FU31 | 7-53 | None |
| A0A5J9VHH5 | 628-667 | None |
| A0A287LJH8 | 1-44 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.