DPCstruct | MC29768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2SUS0 | 142-222 | MAEALALMHWGARIDANDVEFVLAPPRANHTPTFESDYLTVHCMWILDFDCCRPIWVDETGVEQACAAFYKNDPFYPRPGT |
| W6QWD8 | 1-68 | MAEALAMMHWIAGIDANDVEFVLATYNDNDGGRINNVLGRHSMWMLDFDLCRNMTMGENGVAKAVKAF |
| A0A401KI81 | 198-267 | None |
| A0A0G4M1L8 | 412-488 | None |
| N4UFY2 | 2-106 | None |
| C4JKH2 | 182-250 | None |
| A0A1L9VBY2 | 121-189 | None |
| A0A1V8SMG1 | 222-297 | None |
| A0A5N6G8E1 | 28-112 | None |
| A0A0A1SVE8 | 237-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.