DPCstruct | MC29767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 76 ± 19 aa |
| Standard deviation of domain lengths | 18.81 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 54.54 |
| Pfam Score | 90.08 |
| Assigned Pfam label(s) | CL0622- PF07503 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2PIJ5 | 1-68 | MLSADISLCNACRTEKNEPKNRRYKYPFINCTNCEPRYTIIKKLPYDRDFTSMQKFEMCEACAMEYFM |
| A0A6V8KI60 | 113-166 | PDLATCAACLIELFDPADRRYRYPFINCTDCGPRATIVTDLPYDRVRTTMSGFA |
| A0A7I9W1N9 | 90-161 | None |
| A0A2Z5JTV2 | 59-172 | None |
| A0A370DVN0 | 60-161 | None |
| A0A485ARF9 | 6-93 | None |
| A0A6N6ZIU3 | 112-177 | None |
| A0A370DG88 | 129-194 | None |
| A0A6N7ALN1 | 109-165 | None |
| J6JDV8 | 440-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.