DPCstruct | MC2976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 160 ± 15 aa |
| Standard deviation of domain lengths | 14.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835EWX5 | 1-132 | MRDDGTDSATEELLAPRLLVSPTSRVQELEKFSHYVARQIGFDDANECPHLCTLAYDYLRKNKGYEENIFAFFQNNVDPEPLIVKFI… |
| A0A6A4QCY5 | 1-179 | MMQSTVKPESCSPPEYTDHGKTTSFTQIMVASSIGLIFAVAMHYRLKNMRDQKIIPRLRLSKHGHPPKLERFSHYVAGQMGFKDRRS… |
| A0A6J1IIR8 | 1-166 | None |
| A0A453HCW5 | 7-154 | None |
| A0A817AGD8 | 21-199 | None |
| A0A5N6PFG2 | 272-438 | None |
| F6HDZ0 | 8-183 | None |
| A0A2P5BWR0 | 2-141 | None |
| A0A438F632 | 1-140 | None |
| A0A4Y1S0G8 | 134-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.