DPCstruct | MC29758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 96 ± 26 aa |
| Standard deviation of domain lengths | 25.66 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 93.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0486- CL0091 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3C3L8 | 6-83 | LQEALKKGPRTILACGPTPMLAAVARLAQETNSPAYISLEAQMACGTGLCLGCAVKARPGGYLHVCQEGPVVLAEEVE |
| J9FU21 | 2-62 | KFVAELTKRYDIPTIASLNTIMVDGTGMCGACRVTVGGKTKFVCVDGPEFDAHQVDFDEMI |
| K6P208 | 399-495 | None |
| A0A7C6ELT7 | 1-62 | None |
| A0A7J9T0R0 | 105-199 | None |
| A0A7V3K3I0 | 16-108 | None |
| A0A3A4N6L5 | 359-460 | None |
| A0A7Y5LYD3 | 253-354 | None |
| A0A7X7U5C2 | 2-78 | None |
| A0A5Q5GN74 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.