DPCstruct | MC29754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 298 ± 48 aa |
| Standard deviation of domain lengths | 47.82 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 21.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6IZY2 | 2-339 | LLRFIDWCKRHIILVTVLAVILVAAFGFVNIQILHMTSEPEFCHLCHPAKGFGALAEVDSWEHSAHGDAGVSCLDCHGRPGVVGYMK… |
| A0A432UAD0 | 10-294 | LMFFVLVGLSFYLSSCKRAVDIKFSHQLHVEENGISCDQCHPKQEDGTMGLPTMDTCSDCHEIDLDNPSEKCLMCHTSRSASKDYEV… |
| A0A523UYD9 | 9-365 | None |
| A0A523VHW9 | 2-370 | None |
| A0A7C1LU44 | 184-489 | None |
| A0A7V0WE59 | 4-320 | None |
| A0A7V9LAH4 | 8-241 | None |
| A0A3M1QFG4 | 17-340 | None |
| A0A1F2Y8R7 | 54-292 | None |
| A0A832C0Q8 | 2-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.