DPCstruct | MC2975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 5.02 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 62.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4QB85 | 1-80 | MALTATGVGAIWGVVIQIWSNRLRKLPPMRHPWEHVVGMGLGAIFANQYMKWGEQVDKDLEKMLQKAKAANENRYIGYNP |
| A0A090M480 | 4-80 | SAFTAAFGAVSGIGIAAFANGLRKVPAFAQPWKHVAAAGVGAAALVWSADVEDTLRADVEGLRAERRERNAEYMADV |
| A0A7S0X506 | 18-95 | None |
| A0A0D3DF49 | 80-156 | None |
| A0A4V3WLC5 | 131-211 | None |
| A0A835NA33 | 1-78 | None |
| A0A1D6EW24 | 1-95 | None |
| A0A835PG78 | 1-80 | None |
| A0A7N2MUB1 | 1-77 | None |
| A0A6A5MU23 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.