DPCstruct | MC29749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 194 ± 26 aa |
| Standard deviation of domain lengths | 26.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G8LWN6 | 471-669 | ENLGVLQLSLPYKVVTTIAKTNKIYDTDSEKIGFSISGNDLFDLSYGGSNQFNVEFKAVELYGKRITLLWVPATAEDKSIIDSYGGL… |
| G8LY28 | 2-174 | SEQYSDVVSFAIYGQDPFGLNFTGSRDFNLEYKSVDLFNKKVTLSYEPATKEDAAIIEKYGDIFSVPAYLVKMVPVLKIDGETVARG… |
| A0A6M5ZCN0 | 5-183 | None |
| A0A250KVJ8 | 122-334 | None |
| A0A4R6UJI7 | 112-317 | None |
| A0A6I2GXM8 | 535-674 | None |
| A0A426V6R3 | 61-286 | None |
| A0A2S5CFK7 | 159-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.