DPCstruct | MC29748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 64 ± 3 aa |
| Standard deviation of domain lengths | 3.30 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A143PM21 | 65-128 | AVEAQLDYRVVVRDGLPAIEFSFEGFDEGDQVMGRGWAVLEGERLRGRLFFHHGDDSSFVAERE |
| A0A831L737 | 1-60 | DIDGRGEQCGNAPRFEFLWSGQEENDLVCGRGWAVIENGELNGRIYLHLADDSAFRAIRS |
| A0A354PGX1 | 2-59 | None |
| A0A0H3D8P7 | 297-361 | None |
| A0A3M6RLC2 | 2-65 | None |
| A0A059MKE1 | 28-93 | None |
| A0A7Y5C728 | 31-97 | None |
| K0Q1K0 | 25-91 | None |
| A0A441HDP1 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.