DPCstruct | MC29743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 95 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6BUF9 | 22-120 | RTPVWTKSLINQYLLQARQGKLFGAYGISETNALRDGLRHAPGVKNGRILVIGSERPWVEACLLEAGAYNIVTLEYGKIHSEHENIT… |
| A0A7S4KPB4 | 1-101 | FTCRPLTYSKLDIEALVGKVFNYKTSYYGDTDIFVYQALNLLQGLSGKHVVVLGSVEPWYEAMCLAHGADSCTTIDYNRVFYDHPKL… |
| A0A5D6XXL3 | 227-323 | None |
| A0A7R8CJ32 | 671-766 | None |
| A0A8B6CIT0 | 801-898 | None |
| L1JUA5 | 212-314 | None |
| A0A016TTY6 | 133-230 | None |
| A0A368G929 | 1-87 | None |
| A0A7R8H8D4 | 931-1032 | None |
| A0A6V7W1G7 | 106-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.